DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Rbp1

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:113 Identity:40/113 - (35%)
Similarity:53/113 - (46%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.||....:..::...|.:.|.:.::::     .|...|||||.|.|:||||||..|:||....|
  Fly    15 VGNLGSSASKHEIEGAFAKYGPLRNVWV-----ARNPPGFAFVEFEDRRDAEDATRALDGTRCCG 74

  Fly    92 RELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRS 139
            ..:||:|       |..||...|||.||..|..|..|.|.....|..|
  Fly    75 TRIRVEM-------SSGRSRDRRRGEGGSSGRSGSGRYRITPSARTTS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 26/72 (36%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 24/69 (35%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.