DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and pabpn1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001001230.1 Gene:pabpn1 / 407911 XenbaseID:XB-GENE-1007049 Length:296 Species:Xenopus tropicalis


Alignment Length:237 Identity:61/237 - (25%)
Similarity:80/237 - (33%) Gaps:91/237 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNGGGAGGLG-----------------------------AAR----------------------- 14
            |.|||||||.                             .||                       
 Frog    75 SGGGGAGGLEELEDEELEEEEPGELTGDQTIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMN 139

  Fly    15 --PPPRIDGMV-------------SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESR 64
              |||...|.|             |:.|.|:.|..|.|:|...|..||.|..:.|..|:||...:
 Frog   140 MSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPK 204

  Fly    65 GFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRS 129
            |||::.|.||.....:| |:|..:..||:::|...|..||...|...             |..|:
 Frog   205 GFAYIEFSDKESVRTSL-ALDESLFRGRQIKVVPKRTNRPGISTTDR-------------GFPRA 255

  Fly   130 RSRSPMRRRSRSPRRRSY-SRSRSPGSHSPERRSKFSRSPVR 170
            |.|:         |..|| ||||....::|..|.:..|...|
 Frog   256 RYRA---------RASSYSSRSRFYSGYTPRPRGRVYRGRAR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/71 (35%)
pabpn1NP_001001230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 8/26 (31%)
Necessary for homooligomerization. /evidence=ECO:0000250|UniProtKB:Q86U42 146..296 48/166 (29%)
RRM_II_PABPN1 164..239 CDD:409966 27/75 (36%)

Return to query results.
Submit another query.