DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srsf2a

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_998547.1 Gene:srsf2a / 406691 ZFINID:ZDB-GENE-040426-2706 Length:225 Species:Danio rerio


Alignment Length:188 Identity:119/188 - (63%)
Similarity:135/188 - (71%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
            ||||.::||.|||||||||||:||.||||||:.|.|||:||||||||:||||||||||:||||||
Zfish     5 RPPPDVEGMTSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAE 69

  Fly    79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSG---RRGGGGGGGSGGRRRSRSRSPMRR--- 137
            ||::||||.:||||||||||||||||.....|..|   ||.||.|      ||||||||.||   
Zfish    70 DAMDAMDGALLDGRELRVQMARYGRPPDAHYSRRGAPPRRYGGYG------RRSRSRSPRRRKHS 128

  Fly   138 RSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS 195
            |||| |.||.|||||...:|..|...:|||..|..||:...:.....:.:.|||||||
Zfish   129 RSRS-RSRSRSRSRSRSRYSRSRSRSYSRSRSRSRSRSKTRTPRRSKSKSPSRSRSRS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 63/75 (84%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 59/71 (83%)
srsf2aNP_998547.1 RRM <5..>91 CDD:223796 69/85 (81%)
RRM_SRSF2_SRSF8 16..88 CDD:240757 59/71 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586922
Domainoid 1 1.000 126 1.000 Domainoid score I5354
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3665
OMA 1 1.010 - - QHG51897
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - otm26387
orthoMCL 1 0.900 - - OOG6_104633
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.