DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srsf2

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_989328.1 Gene:srsf2 / 394953 XenbaseID:XB-GENE-481125 Length:220 Species:Xenopus tropicalis


Alignment Length:191 Identity:118/191 - (61%)
Similarity:133/191 - (69%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
            ||||.::||.|||||||||||:||.||||||:.|.|||:||||||||:||||||||||:||||||
 Frog     5 RPPPDVEGMTSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAE 69

  Fly    79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRG------GGGGGGSGG---RRRSRSRSP 134
            ||::||||.:||||||||||||||||..   |..||||      |..|..|..   ||||||||.
 Frog    70 DAMDAMDGAVLDGRELRVQMARYGRPPD---SHHGRRGPPPRRYGDYGRRSRSPRRRRRSRSRSK 131

  Fly   135 MRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS 195
            .|.||||..|.|.|:||| .:.|..|.|..|||..|..|::.          :||||||||
 Frog   132 SRSRSRSRSRYSRSKSRS-RTRSRTRSSSKSRSARRSKSKSS----------SASRSRSRS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 63/75 (84%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 59/71 (83%)
srsf2NP_989328.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 59/71 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5371
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3655
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - oto102768
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.