DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and eif3g

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_957293.1 Gene:eif3g / 393974 ZFINID:ZDB-GENE-040426-1076 Length:293 Species:Danio rerio


Alignment Length:106 Identity:33/106 - (31%)
Similarity:57/106 - (53%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 65
            :.:||...| .:.:|..|.|...:::|.||:..|...||:.:|...|.:..||:.:|:.|.:|:|
Zfish   191 LRDGGTRRG-ESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKG 254

  Fly    66 FAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSS 106
            ||.:.|:.:.||..|:..:.|...|...|.|:.|   :||:
Zfish   255 FALISFHRREDAARAIAGVSGFGYDHLILNVEWA---KPSN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/71 (32%)
eif3gNP_957293.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
eIF3g 29..149 CDD:463545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..206 4/15 (27%)
RRM_eIF3G_like 213..288 CDD:409842 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.