DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and PABPN1L

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001372638.1 Gene:PABPN1L / 390748 HGNCID:37237 Length:297 Species:Homo sapiens


Alignment Length:41 Identity:14/41 - (34%)
Similarity:17/41 - (41%) Gaps:11/41 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VAPQPYPQYSAPTMSPVSSLHRSMTPHSVASGGYGPPVDFH 199
            :.|:|.|  :||..||         |.|.|....|.||..|
Human   563 IRPRPPP--AAPAQSP---------PQSPAHSPPGSPVHTH 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751
PABPN1LNP_001372638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.