DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and lark

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:87/246 - (35%) Gaps:87/246 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.|||.:|...::|.:|::.|.|.:..|.|:        :.||......|.:||::.::||::||
  Fly    90 VGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHLDCVGDVQDAIKELNGRVVDG 146

  Fly    92 RELRVQMA-----------------RYGRPSSPTRSSSGRRGGGGGG-------GSGG-RRRSRS 131
            :.|:||::                 |.||....::......|..|||       .:|| |.|...
  Fly   147 QPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYG 211

  Fly   132 RSP----------MRRR-----------------SRSPRRRSYSRSRS----------------P 153
            |.|          :|.|                 ||....|.|..||.                |
  Fly   212 RDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRREPMPLP 276

  Fly   154 GSHSPERRS---------KFS-RSPVRGDSRNGIGSGSGGLAPAASRSRSR 194
            .:.|...||         .|| |||....|.||: |..|...|......||
  Fly   277 PTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGM-SRYGSPTPHGYEDFSR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 23/89 (26%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 21/69 (30%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/69 (30%)
hnRNP-R-Q <88..>258 CDD:273732 42/175 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.