DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srsf3a

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001002053.1 Gene:srsf3a / 368925 ZFINID:ZDB-GENE-030616-631 Length:174 Species:Danio rerio


Alignment Length:192 Identity:67/192 - (34%)
Similarity:80/192 - (41%) Gaps:62/192 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.||.......:|.|.|...|.:..:::     .|...|||||.|.|.|||.||:..:|||.|.|
Zfish    18 VGNLGNSGNKTELERAFGYYGPLRSVWV-----ARNPPGFAFVEFEDPRDATDAVRELDGRTLCG 77

  Fly    92 RELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSP-----------------MRRRS 139
            ..:||:|                        |.|.:|||.|.|                 .||||
Zfish    78 CRVRVEM------------------------SNGEKRSRFRGPPPSWSRRPRDDYRRGDDYRRRS 118

  Fly   140 ------RSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS 195
                  ||| |||:||||| .|.|.|||.:.|.|..|....:...||        |||||||
Zfish   119 SPPARHRSP-RRSFSRSRS-RSLSRERRRERSLSRDRNYKPSRSFSG--------SRSRSRS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 28/72 (39%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/69 (38%)
srsf3aNP_001002053.1 RRM_SF 10..90 CDD:302621 30/100 (30%)
RRM <13..>97 CDD:223796 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.