DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and tra2

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:164 Identity:53/164 - (32%)
Similarity:69/164 - (42%) Gaps:46/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |..|...|:...:|.:|.:.|.:..|.:..|..|:.||||.|:.|....||..|.::..|..:||
  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165

  Fly    92 RELRVQMARYGRPSSPT--------------RSSSGRRGGGGGGGSGGRR--RSRSRSP------ 134
            |.:||..:...|..:||              ||.|.||         |||  ..||.||      
  Fly   166 RRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRR---------GRRVYHDRSASPYDNYRD 221

  Fly   135 ------------MRR---RSRSPRRRSYSRSRSP 153
                        :||   |:|..|.|||||||||
  Fly   222 RYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/69 (33%)
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 24/73 (33%)

Return to query results.
Submit another query.