DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and rbm7

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:142 Identity:37/142 - (26%)
Similarity:63/142 - (44%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            :|.|.||..:.|.|.:..:|.:.|.:..:.||::. ..:|:.||||.|..:.....||..::|..
Zfish    10 TLFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNN-EGKSKLFAFVNFKHEVSVPYALNLLNGIR 73

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSP 153
            |.||:|.::.          ::.|......|...:..:..|.:.:|..|..|:|.:.. |.|.||
Zfish    74 LHGRQLNIKF----------KTGSSHINQEGKSPANSQNPSPANTPGHRGGRTPEQMG-SPSYSP 127

  Fly   154 GSH------SPE 159
            ..|      ||:
Zfish   128 PQHMQRPFSSPD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/71 (32%)
rbm7NP_956219.1 RRM_RBM7 8..82 CDD:410005 23/72 (32%)
PABP-1234 <11..195 CDD:130689 37/141 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252
PRK12678 <171..>248 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.