DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Pabpn1l

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001107251.1 Gene:Pabpn1l / 307920 RGDID:1562761 Length:269 Species:Rattus norvegicus


Alignment Length:137 Identity:41/137 - (29%)
Similarity:63/137 - (45%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            |:.|.|:.|..:..:|...|..|||:..:.|..|:::...:|:|::.|..|...:.|:. :|...
  Rat   140 SVYVGNVDYGGSAAELEAYFSPCGEIHRVTILCDKFSGHPKGYAYIEFASKSSVQAAVR-LDEST 203

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRS--RSPRRRSYSRSR 151
            ..||.::|...|...|.    .||..||       |.|..|.||:...:.|  |.||.|.:.:||
  Rat   204 FRGRVIKVLPKRTNFPG----ISSTDRG-------GLRTHSSSRAAFLQGSLQRKPRLRPHGQSR 257

  Fly   152 SPGSHSP 158
            ..|..||
  Rat   258 GRGRASP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 18/71 (25%)
Pabpn1lNP_001107251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..54
RRM_SF 140..216 CDD:473069 20/76 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..269 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.