DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBMX

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:195 Identity:69/195 - (35%)
Similarity:88/195 - (45%) Gaps:44/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            |.:..|...|..:.|..||.:.|.:.::.:.:||.|.:|||||||.|....||:||...|:|:.|
Human    10 LFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly    90 DGRELRVQMA-----RYGR--PSSPTRSSSGRRG-GGGGGGSGGRR------------------- 127
            ||:.::|:.|     ..||  |..|.||....|| .||.|||||.|                   
Human    75 DGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFN 139

  Fly   128 RSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSR 192
            .|.||.|:..:...|     .||..|    |.:||..| .|||.      .||.||.|| .||.|
Human   140 MSSSRGPLPVKRGPP-----PRSGGP----PPKRSAPS-GPVRS------SSGMGGRAP-VSRGR 187

  Fly   193  192
            Human   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/71 (38%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 29/75 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 51/144 (35%)
dnaA 165..>306 CDD:455861 14/31 (45%)
RBM1CTR 173..217 CDD:400429 9/22 (41%)
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236 1/2 (50%)
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.