DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and tif307

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_595727.1 Gene:tif307 / 2540819 PomBaseID:SPBC18H10.03 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:28/81 - (34%)
Similarity:48/81 - (59%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84
            |...:|:|.||:..|..|:||.:|.|.|.:..:|:.:|:.|..::|||||.:||:..|..|.:.:
pombe   199 DDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYDRDCAIKARDRL 263

  Fly    85 DGRMLDGRELRVQMAR 100
            ||...:...||.:.::
pombe   264 DGYGWNNLILRCEFSK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/71 (38%)
tif307NP_595727.1 eIF3g 21..148 CDD:463545
RRM_eIF3G_like 203..278 CDD:409842 27/74 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.