DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srp1

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_596398.1 Gene:srp1 / 2539818 PomBaseID:SPBC11C11.08 Length:275 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:80/206 - (38%)
Similarity:97/206 - (47%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGMVSLKVDNLTYRTTPEDLRRVFE---RCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDAL 81
            |||   :...|.|...|      |.   ||    ||.|||   ||.||.||||.:.|.||||||.
pombe    16 DGM---RARELAYEFEP------FGPLIRC----DIPIPR---TRTSRPFAFVEYEDSRDAEDAY 64

  Fly    82 EAMDGRMLD--GRELRVQMARYGRPSSPTRSSSGRRGGGGG-GGSGGRRRSRSRSPMRRRSRSP- 142
            ..:.||.|:  |..|||:.|:...||.|.....|||..||. .|..||.||||.||...||||| 
pombe    65 YEVHGRRLERGGGVLRVEWAKQPPPSGPGSKRGGRRERGGRVHGDSGRLRSRSPSPHEARSRSPY 129

  Fly   143 ------RR----RSYSRSRSPG--SHSP--ERRS-----------KFS--RSPVRGDSRNGIGSG 180
                  ||    |..||||||.  |.||  :|||           .|:  :|||..::...:.:|
pombe   130 NDERSDRRSMSPRYRSRSRSPDGRSRSPDYDRRSPKRNHRSPSPVSFAPQKSPVENETETNVDNG 194

  Fly   181 SGGLAPAASRS 191
            ...::.:..:|
pombe   195 DTKISESNEKS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 33/80 (41%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 32/76 (42%)
srp1NP_596398.1 RRM_Srp1p_like 8..85 CDD:240913 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1801
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.