DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SPBC13G1.14c

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_596549.2 Gene:SPBC13G1.14c / 2539695 PomBaseID:SPBC13G1.14c Length:243 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:42/160 - (26%)
Similarity:72/160 - (45%) Gaps:15/160 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 66
            ||...:..|..:...|    :.::.|:|||...|.|.:..:|...|.:..|::|..:.:..::|:
pombe    82 SNRSYSSSLSRSPEEP----LRTILVENLTRNVTKEHIAEIFGIYGLIDHIFMPIYKKSELNKGY 142

  Fly    67 AFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRS 131
            .::.:.....|.:|::.|:...|||.||.|.:.|:  |......:....       ....|.|||
pombe   143 CYIEYVYHDQAANAVDKMNNAELDGEELFVSIKRF--PFESLHKNHKHY-------ENSYRPSRS 198

  Fly   132 RSPMRRRSRSPRRRSYS--RSRSPGSHSPE 159
            ::......:|..|..||  |||||||:..|
pombe   199 QNNSHYNDKSFHRSRYSRARSRSPGSNISE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 20/75 (27%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 19/71 (27%)
SPBC13G1.14cNP_596549.2 RRM <94..243 CDD:223796 39/148 (26%)
RRM_RNPS1 101..173 CDD:240811 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.