DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and 4930595M18Rik

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_775611.2 Gene:4930595M18Rik / 245492 MGIID:3045300 Length:829 Species:Mus musculus


Alignment Length:179 Identity:61/179 - (34%)
Similarity:87/179 - (48%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEA 83
            :|||..|||:||.:.|:...|:.|||..|.:||:||||:..|.|..||||:.||:|.||.|||.:
Mouse    10 VDGMTCLKVENLAHHTSSYTLKHVFEDYGPLGDVYIPRNHLTEEHYGFAFIHFYNKCDANDALHS 74

  Fly    84 MDGRMLDGRELRVQMA-----RYGRPSSPTRSSSGR---------------------------RG 116
            ::|.:|||.:|:|||.     .|.:|.    .||||                           |.
Mouse    75 LNGFLLDGCKLKVQMVYNDDPHYAQPD----CSSGRQYQYKEENHDLQSECERQHFSNTRIQTRS 135

  Fly   117 GGGGGGSGGRRRSRSRSPMRRRSRSPR---RRSYSRSRSPGSHSPERRS 162
            .....|.....:|:|.:.:.|||.|.|   :.|.|..:.|....|:.::
Mouse   136 HSRSSGDDSEFKSQSSNHLHRRSSSTRFKTQSSVSTQQLPNRACPKSKN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 39/80 (49%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 36/71 (51%)
4930595M18RikNP_775611.2 RRM <14..176 CDD:223796 56/165 (34%)
RRM_SF 16..88 CDD:302621 36/71 (51%)
zf-RING_2 775..816 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.