DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Srsf7

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_666195.1 Gene:Srsf7 / 225027 MGIID:1926232 Length:238 Species:Mus musculus


Alignment Length:206 Identity:78/206 - (37%)
Similarity:96/206 - (46%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALE 82
            |..|...:.|.||.......:|.|.|...|.:..::|     .|...|||||.|.|.||||||:.
Mouse     6 RYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWI-----ARNPPGFAFVEFEDPRDAEDAVR 65

  Fly    83 AMDGRMLDGRELRVQM-------ARYGRPSSPTRSSSGRRGGGGGGGSGG-----------RRRS 129
            .:||:::.|..:||::       :|:.||  |.|............|..|           ||||
Mouse    66 GLDGKVICGSRVRVELSTGMPRRSRFDRP--PARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRS 128

  Fly   130 RSRSPMRRRSRSPRRRSYSRSRSPG----SHSPER-RS---KFSRSPVRGDSRNG--IGSGSGGL 184
            ||||....|||. ||.|.|||||.|    |.||.| ||   :.|||.....||:|  |||   ..
Mouse   129 RSRSRSHSRSRG-RRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGS---RY 189

  Fly   185 APAASRSRSRS 195
            ..:.|||||||
Mouse   190 FQSRSRSRSRS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 26/71 (37%)
Srsf7NP_666195.1 RRM_SRSF7 12..88 CDD:410050 27/80 (34%)

Return to query results.
Submit another query.