DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and T08B6.1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_500665.2 Gene:T08B6.1 / 188275 WormBaseID:WBGene00020351 Length:96 Species:Caenorhabditis elegans


Alignment Length:41 Identity:11/41 - (26%)
Similarity:20/41 - (48%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SGGRRRSRSRSPMRRRSRSP--RRRSYSRSRSPGSHSPERR 161
            ||.:.|:|..:...:|:..|  .:.:.|||:......|.:|
 Worm    32 SGFKFRNRKVTVTTKRTNKPGFGKTTASRSQCHAKPRPGQR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751
T08B6.1NP_500665.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.