DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Ncl

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_035010.3 Gene:Ncl / 17975 MGIID:97286 Length:707 Species:Mus musculus


Alignment Length:171 Identity:54/171 - (31%)
Similarity:69/171 - (40%) Gaps:37/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            :|.|..|:..||.|.|:..||  |.| ...|..||.|..|:||.||.|..:.||:.|.|||:...
Mouse   570 TLFVKGLSEDTTEETLKESFE--GSV-RARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGE 631

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRGGGGG--GGSGGRRRSRSRSPMRRRSRSPRRRSYSRSR 151
            :||.::.:..|   :|..  ....|.||||.|  ||.||.|..|                     
Mouse   632 IDGNKVTLDWA---KPKG--EGGFGGRGGGRGGFGGRGGGRGGR--------------------- 670

  Fly   152 SPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSR 192
              |......|..|..   ||..|.|.| |.|...|...:::
Mouse   671 --GGFGGRGRGGFGG---RGGFRGGRG-GGGDFKPQGKKTK 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 29/71 (41%)
NclNP_035010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308
PRK13808 <12..142 CDD:172341
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 309..383 CDD:409837
RRM2_NCL 392..467 CDD:409838
RRM3_NCL 486..558 CDD:409839
RRM4_NCL 569..646 CDD:409840 31/81 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..707 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.