DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and sgnh-1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_500666.2 Gene:sgnh-1 / 177260 WormBaseID:WBGene00020354 Length:177 Species:Caenorhabditis elegans


Alignment Length:150 Identity:36/150 - (24%)
Similarity:63/150 - (42%) Gaps:30/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            |:.|.|:.:::|..::...|..||:|..:.||:|::|...:.||||.|......:.|| .:.|.|
 Worm    47 SVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFAFVEFQKLESVQLAL-VLSGTM 110

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSP 153
            ...|::.|.:.|..:|                    |..|:.:       ::.|...:.|....|
 Worm   111 FRNRKIMVTLKRTNKP--------------------GMGRTAT-------AQKPAHFAKSSHGKP 148

  Fly   154 GSHSPERRSK--FSRSPVRG 171
            |||......|  :..:|:.|
 Worm   149 GSHQGVTVVKYVYVNAPING 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
sgnh-1NP_500666.2 RRM_II_PABPs 47..119 CDD:409747 22/72 (31%)

Return to query results.
Submit another query.