DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and tiar-2

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_496718.1 Gene:tiar-2 / 174909 WormBaseID:WBGene00012904 Length:434 Species:Caenorhabditis elegans


Alignment Length:212 Identity:55/212 - (25%)
Similarity:78/212 - (36%) Gaps:81/212 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGGAGG-----------------LGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGD 51
            |||.||                 ..||       ...|:.|.|:. ....:::||.|:|.|.:.:
 Worm   227 GGGGGGRDRYHNQSEKTYDEIFNQAAA-------DNTSVYVGNIA-NLGEDEIRRAFDRFGPINE 283

  Fly    52 IYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRG 116
            :      .|.:.:|:|||:|..|..|..|:..|:...:.|:.:|....:.|....|:...||..|
 Worm   284 V------RTFKIQGYAFVKFETKESAARAIVQMNNADIGGQIVRCSWGKSGDSGKPSERGSGGGG 342

  Fly   117 G-----------GGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFS----R 166
            |           ||||||||                           ||:      |:||    |
 Worm   343 GSGNYGYGYGNSGGGGGSGG---------------------------PGN------SQFSNFNQR 374

  Fly   167 SPVRGDSRNGIGSGSGG 183
            .|..|:  .|.|.||||
 Worm   375 PPPSGN--GGSGGGSGG 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 19/71 (27%)
tiar-2NP_496718.1 PABP-1234 41..>317 CDD:130689 25/103 (24%)
RRM_SF 133..207 CDD:473069
RRM3_TIA1_like 256..325 CDD:409790 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.