DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and eif-3.G

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001263666.1 Gene:eif-3.G / 174346 WormBaseID:WBGene00001230 Length:262 Species:Caenorhabditis elegans


Alignment Length:81 Identity:27/81 - (33%)
Similarity:44/81 - (54%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLD 90
            :|.||......::||.:|.:.|.|..|:|.||:.|...:|||||.|..:.||..|:..::...:.
 Worm   185 RVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMY 249

  Fly    91 GRELRVQMARYGRPSS 106
            ...|:|:   :.|||:
 Worm   250 HMVLKVE---WTRPSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/70 (33%)
eif-3.GNP_001263666.1 eIF3G 33..143 CDD:240597
RRM_eIF3G_like 183..257 CDD:409842 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.