DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and rsp-4

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001379856.1 Gene:rsp-4 / 173915 WormBaseID:WBGene00004701 Length:196 Species:Caenorhabditis elegans


Alignment Length:215 Identity:115/215 - (53%)
Similarity:140/215 - (65%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 65
            ||.|||    |..|..|.|:|:.|||:|||:|:|||.||||.|||.|::||::||||:|:|:|:|
 Worm     1 MSRGGG----GDRRAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKG 61

  Fly    66 FAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRS- 129
            |.|||||::||||.||:..||:::|||||||.:|:|.|||.       .|||.|||  |||||| 
 Worm    62 FGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKYDRPSD-------ERGGRGGG--GGRRRSR 117

  Fly   130 ----RSRSPMRRRSRSPRRRSYSRSRSPGSH----SPERRSKFSRS-----PVRGD-------SR 174
                |||||...||||| |||.||:|||.|.    ||:||.. |||     |.|.|       ||
 Worm   118 SPRRRSRSPRYSRSRSP-RRSRSRTRSPPSRDRRDSPDRRDN-SRSRSRSPPPREDGSPKERRSR 180

  Fly   175 NGIGSGSGGLAPAASRSRSR 194
                |.|...:|:.|||.||
 Worm   181 ----SRSASRSPSRSRSNSR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 49/75 (65%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 47/71 (66%)
rsp-4NP_001379856.1 RRM_SRSF2_SRSF8 21..93 CDD:409751 47/71 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162498
Domainoid 1 1.000 109 1.000 Domainoid score I3993
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I2609
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51897
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - oto19835
orthoMCL 1 0.900 - - OOG6_104633
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.