DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SRSF12

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_542781.3 Gene:SRSF12 / 135295 HGNCID:21220 Length:261 Species:Homo sapiens


Alignment Length:205 Identity:79/205 - (38%)
Similarity:102/205 - (49%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
            |||     ..||.:.|:...|.||||||.|.|.|.:.|:|||.|.|||..||||:|:|.|.||||
Human     6 RPP-----NTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAE 65

  Fly    79 DALEAMDGRMLDGRELRVQMARYGR------------PSSPTRSSSGRRGGGGGGGSGGRRRSRS 131
            |||..::.:.:.||::.:|.|:..|            |.||:.....|        |..:||:||
Human    66 DALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSR--------SPSQRRTRS 122

  Fly   132 RSPM----RRRSRS-----PRRRSYSRSRSPGSHSPER--RSKFSRSPVRGDSRNGIGSGSGGLA 185
            ||..    ||||.|     .||.|||:|:|.....|.|  .::.||:|     |...||      
Human   123 RSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTP-----RRNFGS------ 176

  Fly   186 PAASRSRSRS 195
              ..||||:|
Human   177 --RGRSRSKS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 38/75 (51%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 36/71 (51%)
SRSF12NP_542781.3 RRM_SRSF10_SRSF12 10..93 CDD:240758 40/82 (49%)
PABP-1234 <12..211 CDD:130689 75/194 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..261 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.