DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Cirbp

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001366350.1 Gene:Cirbp / 12696 MGIID:893588 Length:176 Species:Mus musculus


Alignment Length:159 Identity:61/159 - (38%)
Similarity:83/159 - (52%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            |.|..|::.|..:.|.:||.:.|::.::.:.:||.|:.||||.||.|.:..||:||:.||:|:.:
Mouse     8 LFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72

  Fly    90 DGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSPG 154
            |||::||..|  |: ||..||...|  ||..||.|..|..|||.  |..||....|.|...|.. 
Mouse    73 DGRQIRVDQA--GK-SSDNRSRGYR--GGSAGGRGFFRGGRSRG--RGFSRGGGDRGYGGGRFE- 129

  Fly   155 SHSPERRSKFSRSPVRGDSRNGIGSGSGG 183
                      |||...|.||:...|.|.|
Mouse   130 ----------SRSGGYGGSRDYYASRSQG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 30/74 (41%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 29/71 (41%)
CirbpNP_001366350.1 RRM_CIRBP_RBM3 6..85 CDD:409883 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1239
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.