DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SRSF8

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_115285.1 Gene:SRSF8 / 10929 HGNCID:16988 Length:282 Species:Homo sapiens


Alignment Length:214 Identity:119/214 - (55%)
Similarity:141/214 - (65%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDK 74
            :...||||.:|||::||||||||||:|:.||||||:.|.|||:||||:.:|:..||||||||:|:
Human     1 MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDR 65

  Fly    75 RDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGR-RGGGGGGGSGGRRRS---RSRSPM 135
            |||:||..||||..|||||||||:|||||...| ||..|. ||...|||.|.|.||   |||||.
Human    66 RDAQDAEAAMDGAELDGRELRVQVARYGRRDLP-RSRQGEPRGRSRGGGYGRRSRSYGRRSRSPR 129

  Fly   136 RR---RSRSP---RRRSYSR------SRSPGSHSPERRSKFSRSPVR----GDSRNGIGS--GSG 182
            ||   |||.|   |.||.||      ||||.|.||..||::||||..    .:||.| ||  .|.
Human   130 RRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYG-GSHYSSS 193

  Fly   183 GLAPA------ASRSRSRS 195
            |.:.:      :|||.|:|
Human   194 GYSNSRYSRYHSSRSHSKS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 53/75 (71%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 51/71 (72%)
SRSF8NP_115285.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 51/71 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..282 58/124 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152425
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3715
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - otm40641
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.