Sequence 1: | NP_001188794.1 | Gene: | SC35 / 53444 | FlyBaseID: | FBgn0265298 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_473357.1 | Gene: | SRSF10 / 10772 | HGNCID: | 16713 | Length: | 262 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 86/207 - (41%) |
---|---|---|---|
Similarity: | 105/207 - (50%) | Gaps: | 36/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
Fly 79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGR-------RRSRSRSPMR 136
Fly 137 RRSRSPR-----RRSYS--------RSRSPGSHSPERRSK-----FSRSPVRGDSRNGIGSGSGG 183
Fly 184 LAPAASRSRSRS 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SC35 | NP_001188794.1 | RRM | <24..>100 | CDD:223796 | 38/75 (51%) |
RRM_SRSF2_SRSF8 | 25..97 | CDD:240757 | 36/71 (51%) | ||
SRSF10 | NP_473357.1 | RRM_SF | 5..99 | CDD:418427 | 44/98 (45%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..262 | 39/88 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1533297at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |