DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and RIE1

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_011766.3 Gene:RIE1 / 853165 SGDID:S000003482 Length:781 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:30/123 - (24%)
Similarity:51/123 - (41%) Gaps:30/123 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSRNECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDL------KNR------------------ 41
            |.::.|..:||.::|.....:|:.|.:..||::..|.:      ||:                  
Yeast   534 MSNQQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGS 598

  Fly    42 -RGPPFAFVEFEDARDADDAVKARDGYDYDGYR-LRVEFPRGGGPGSYRGGNRNDRSR 97
             ||  :.||.||...||..|:...|||.....: |.|.|.:  ..|:....:.:|:|:
Yeast   599 SRG--YGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQ--KRGNLSSSDDDDQSQ 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069 26/102 (25%)
RRM2_SRSF1_like 115..188 CDD:410013
RIE1NP_011766.3 PABP-1234 195..757 CDD:130689 30/123 (24%)
RRM3_CELF1-6 542..634 CDD:409797 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.