powered by:
Protein Alignment SF2 and PTI1
DIOPT Version :9
Sequence 1: | NP_001247139.1 |
Gene: | SF2 / 53443 |
FlyBaseID: | FBgn0283477 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011672.1 |
Gene: | PTI1 / 853060 |
SGDID: | S000003388 |
Length: | 425 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 57 |
Identity: | 13/57 - (22%) |
Similarity: | 24/57 - (42%) |
Gaps: | 10/57 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPP--------FAFVEFEDARDA 57
:.:.||||:.....|..:....|.| :|:|.:..|. |.::..:|.:.|
Yeast 22 LQITNLPPEWNQDIITSVVAGSGPV--IDIKAKNDPRTGKLTGVLFDYLTSKDCKRA 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0724 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.