DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and PIN4

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_009502.1 Gene:PIN4 / 852229 SGDID:S000000147 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:27/149 - (18%)
Similarity:53/149 - (35%) Gaps:42/149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLF------------HKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAV 61
            |.:.|:|..|:.:.:.|:.            :.|....|      ||  .||..|....:....:
Yeast    87 IVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIF------RG--LAFANFTTPEETTQVI 143

  Fly    62 KARDGYDYDGYRLRVEF------------------PRGGGPGSYRGGNRNDRSRDGGGRMGGRG- 107
            .:.:|.:..|.:|:||:                  .||.....:|  :.::.|.|...:|.|.| 
Yeast   144 TSLNGKEISGRKLKVEYKKMLPQAERERIEREKREKRGQLEEQHR--SSSNLSLDSLSKMSGSGN 206

  Fly   108 -PPAKRSQYRVMVTGLPAS 125
             ..:....:..::.|:.|:
Yeast   207 NNTSNNQLFSTLMNGINAN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 17/100 (17%)
RRM2_SRSF1_like 115..188 CDD:410013 2/11 (18%)
PIN4NP_009502.1 RRM_PIN4_like 84..162 CDD:240699 17/82 (21%)
R3H_RRM 305..367 CDD:100068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.