DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and AT1G60000

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:78 Identity:14/78 - (17%)
Similarity:29/78 - (37%) Gaps:23/78 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLTDISAAGLNSFFFVKSSIFGTNFALNIIERVVPIPTGYIYFVSGNNIQQISRVSFPTGIVYDS 220
            |...:|:..|:   :::.|:.|.:.||..:..::.||                    |..:|..|
plant    45 GQVMLSSCSLD---YIQMSLVGRSLALIGMTSLMSIP--------------------PLNLVDFS 86

  Fly   221 VKKSIFVTSSTRN 233
            ..:.:|..:...|
plant    87 FMEYVFPVADLEN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069
RRM2_SRSF1_like 115..188 CDD:410013 7/31 (23%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:473069 3/14 (21%)
RRM 178..257 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.