DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and RBP47C'

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_175181.1 Gene:RBP47C' / 841159 AraportID:AT1G47500 Length:434 Species:Arabidopsis thaliana


Alignment Length:176 Identity:44/176 - (25%)
Similarity:73/176 - (41%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFH------KFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGY 67
            |:||:|.||:....:.:.|.      |..||. :|....|...:.||.|.|..:...|:...:|.
plant   201 IFVGDLAPDVSDALLHETFSEKYPSVKAAKVV-LDANTGRSKGYGFVRFGDENERTKAMTEMNGV 264

  Fly    68 DYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPA--KRSQ-----YRVMVTGLPAS 125
            ......:|:      ||.:       .|..:|..:.||..|..  .||:     ..:.|.||.:|
plant   265 KCSSRAMRI------GPAT
-------PRKTNGYQQQGGYMPSGAFTRSEGDTINTTIFVGGLDSS 316

  Fly   126 GSWQDLKDHMREAGDVCFAD-TYKDGSGVVEFLRHEDMKYAIKKLD 170
            .:.:|||....|.|::.... ....|.|.|:|:...:.:.|::||:
plant   317 VTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069 19/76 (25%)
RRM2_SRSF1_like 115..188 CDD:410013 16/57 (28%)
RBP47C'NP_175181.1 RRM1_SECp43_like 104..186 CDD:409780
RRM2_SECp43_like 198..277 CDD:409781 21/82 (26%)
RRM3_NGR1_NAM8_like 305..376 CDD:409782 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.