DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and UBP1B

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_564018.1 Gene:UBP1B / 838309 AraportID:AT1G17370 Length:419 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:62/168 - (36%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CR-IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYD 70
            || :||||:...:....:|::|...|.|....|..:....:.||.:.|.|.|..|:.:.:|....
plant    53 CRSVYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKSSYGFVHYFDRRSAGLAILSLNGRHLF 117

  Fly    71 GYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQ----YRVMVTGLPASGSWQDL 131
            |..::|.:       :|..|.|.|.|......:|...|....:.    :.|..|...|...|...
plant   118 GQPIKVNW-------AYASGQREDTSSHFNIFVGDLSPEVTDAMLFTCFSVYPTCSDARVMWDQK 175

  Fly   132 KDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKL 169
            ....|             |.|.|.|...:|.:.||.::
plant   176 TGRSR-------------GFGFVSFRNQQDAQTAIDEI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069 20/73 (27%)
RRM2_SRSF1_like 115..188 CDD:410013 12/55 (22%)
UBP1BNP_564018.1 RRM1_PUB1 56..126 CDD:410026 18/76 (24%)
RRM2_PUB1 138..217 CDD:410031 14/76 (18%)
RRM3_PUB1 260..336 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.