DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and AT5G53680

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_200179.1 Gene:AT5G53680 / 835449 AraportID:AT5G53680 Length:169 Species:Arabidopsis thaliana


Alignment Length:59 Identity:21/59 - (35%)
Similarity:31/59 - (52%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFV----DLKNRRGPPFAFVEFEDARDADDAVK 62
            :||||.||...|.:.:.:.|.:||::..|    |.:..|...:.||.|:||..|..|.|
plant    14 KIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACK 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069 21/59 (36%)
RRM2_SRSF1_like 115..188 CDD:410013
AT5G53680NP_200179.1 RRM_SF 13..88 CDD:473069 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.