DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Cstf2t

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_112539.2 Gene:Cstf2t / 83410 MGIID:1932622 Length:632 Species:Mus musculus


Alignment Length:237 Identity:53/237 - (22%)
Similarity:92/237 - (38%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRR--GPP--FAFVEFEDARDADDAVKARDGYDY 69
            ::|||:|.:...:.::|:|.:.|.|....|...|  |.|  :.|.|::|...|..|::..:|.::
Mouse    18 VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 82

  Fly    70 DGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGP--PAKRSQY-------------RVMV 119
            .|..|||:               |..|......:...||  |...|.|             ...|
Mouse    83 SGRALRVD---------------NAASEKNKEELKSLGPAAP
IIDSPYGDPIDPEDAPESITRAV 132

  Fly   120 TGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAY- 183
            ..||....::.:| .|:    :|..:::::...::  |::..:.||:.:. ....|..:.|:|. 
Mouse   133 ASLPPEQMFELMK-QMK----LCVQNSHQEARNML--LQNPQLAYALLQA-QVVMRIMDPEIALK 189

  Fly   184 -----IRV--------REDSGDNDRGGGGGGSGGGGGGSGGG 212
                 |.|        :..||....|.|..|.||.|.|...|
Mouse   190 ILHRKIHVTPLIPGKSQPVSGPGPGGPGPSGPGGPGPGPAPG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 22/74 (30%)
RRM2_SRSF1_like 115..188 CDD:410013 15/99 (15%)
Cstf2tNP_112539.2 RRM <16..>109 CDD:223796 26/105 (25%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 22/88 (25%)
CSTF2_hinge 113..191 CDD:291025 14/85 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..296 10/31 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..433
8 X 5 AA tandem repeats of M-E-T-R-[AG] 428..466
12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 508..565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..590
CSTF_C 588..628 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.