DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and RS40

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:271 Identity:87/271 - (32%)
Similarity:119/271 - (43%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDY--DG 71
            ::.||...|.|..|::.||.|:|||..||:|    ..||||..||.|||:||::|.|.:::  .|
plant     4 VFCGNFEYDAREGDLERLFRKYGKVERVDMK----AGFAFVYMEDERDAEDAIRALDRFEFGRKG 64

  Fly    72 YRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGS-WQDLKDHM 135
            .|||||:.:     |.|||::    |.|||  ..|...:.|....:.|....|..: .:||:.|.
plant    65 RRLRVEWTK
-----SERGGDK----RSGGG--SRRSSSSMRPSKTLFVINFDADNTRTRDLEKHF 118

  Fly   136 REAGDVC-------FADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDN 193
            ...|.:.       ||           |:::|..:.|.:.||.|.......:|  |.|.....|:
plant   119 EPYGKIVNVRIRRNFA-----------FIQYEAQEDATRALDASNNSKLMDKV--ISVEYAVKDD 170

  Fly   194 DRGGGGGGSGGGGGGSGGGGSRDYRDRS---RSRSFSSRPRRRGTPTY----SPV---RRQ---- 244
            |..|            .|......||||   |.||.|...|.||:|.|    |||   |::    
plant   171 DARG------------NGHSPERRRDRSPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSP 223

  Fly   245 SYSRSRSRSNY 255
            .|.|.||.|.|
plant   224 DYGRRRSPSPY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/72 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 17/80 (21%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 33/72 (46%)
RRM_SF 98..167 CDD:388407 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.