DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and RS31

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:255 Identity:76/255 - (29%)
Similarity:110/255 - (43%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY- 72
            ::|||...:.|..|::.||.|:|:|..||:|:    .:|||.|||.|||:||::..|.:.: || 
plant     4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKS----GYAFVYFEDERDAEDAIRKLDNFPF-GYE 63

  Fly    73 --RLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGL-PASGSWQDLKDH 134
              ||.||:.:|     .||..|.|          .:.|...:....:.|... |......|::.|
plant    64 KRRLSVEWAK
G-----ERGRPRGD----------AKAPSNLKPTKTLFVINFDPIRTKEHDIEKH 113

  Fly   135 MREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGGGG 199
            ....|.|......::.| .|:|...||...|::....|:.......|.| .:::|...:||.|| 
plant   114 FEPYGKVTNVRIRRNFS-FVQFETQEDATKALEATQRSKILDRVVSVEY-ALKDDDERDDRNGG- 175

  Fly   200 GGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTY----SP--VRRQS--YSRSRS 251
                                ||..||.|...|||.:|.|    ||  .||.|  |.|:||
plant   176 --------------------RSPRRSLSPVYRRRPSPDYGRRPSPGQGRRPSPDYGRARS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 31/73 (42%)
RRM2_SRSF1_like 115..188 CDD:410013 15/73 (21%)
RS31NP_567120.1 RRM_SF 2..73 CDD:418427 31/73 (42%)
RRM2_AtRSp31_like 94..163 CDD:409899 15/70 (21%)
PTZ00449 <138..209 CDD:185628 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.