DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and NUC-L2

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:262 Identity:60/262 - (22%)
Similarity:84/262 - (32%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GSRNECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPF---AFVEFEDARDADDAVKA 63
            ||:.   ::.|||...|...||::.|.:.|:|..|.|.:.....|   ..:||....:|..|:: 
plant   382 GSKT---LFAGNLSYQIARSDIENFFKEAGEVVDVRLSSFDDGSFKGYGHIEFASPEEAQKALE- 442

  Fly    64 RDGYDYDGYRLRVEF------PRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYR-VMVTG 121
            .:|....|..:|::.      ||...||           |.|.|           ||.| :.|.|
plant   443 MNGKLLLGRDVRLDLANERGTPRNSNPG-----------RKGEG-----------SQSRTIYVRG 485

  Fly   122 LPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRV 186
            ..:|....::|..:|.....|                                    |||..:.|
plant   486 FSSSLGEDEIKKELRSHFSKC------------------------------------GEVTRVHV 514

  Fly   187 REDSGDNDRGGGGG-----------------GSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRG 234
               ..|.:.|...|                 ||..|||......||. ||....|| |:|...||
plant   515 ---PTDRETGASRGFAYIDLTSGFDEALQLSGSEIGGGNIHVEESRP-RDSDEGRS-SNRAPARG 574

  Fly   235 TP 236
            .|
plant   575 AP 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 20/85 (24%)
RRM2_SRSF1_like 115..188 CDD:410013 11/73 (15%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 19/79 (24%)
RRM2_NUCLs 480..556 CDD:409885 18/114 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.