DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tia1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_997793.1 Gene:tia1 / 793165 ZFINID:ZDB-GENE-030131-1506 Length:386 Species:Danio rerio


Alignment Length:203 Identity:41/203 - (20%)
Similarity:72/203 - (35%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARD 65
            |...::||:|.|:|.|.||:..|..||:::    ..|:...:...:.||.|.:..||::|::...
Zfish    94 NHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMG 158

  Fly    66 GYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRV------------- 117
            |....|.::|..:                         ..|.|||.::.|..             
Zfish   159 GQWLGGRQIRTNW-------------------------ATRKPPAPKATYETNTKHLSFDEVVNQ 198

  Fly   118 ------------MVTGLPASGSWQDLKDHMREAGDVCFADTYKD-GSGVVEFLRHEDMKYAIKKL 169
                        :.|||    :.|.::......|.:.....:.| |...|.|..||...:||..:
Zfish   199 SSPSNCTVYCGGVTTGL----TEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSV 259

  Fly   170 DDSRFRSH 177
            :.:....|
Zfish   260 NGTSLEGH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 22/78 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 15/89 (17%)
tia1NP_997793.1 ELAV_HUD_SF 6..270 CDD:273741 41/203 (20%)
RRM1_TIA1 9..82 CDD:241059
RRM2_TIA1 95..174 CDD:241062 21/103 (20%)
RRM3_TIA1 204..277 CDD:241065 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.