DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and TIAL1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens


Alignment Length:202 Identity:46/202 - (22%)
Similarity:74/202 - (36%) Gaps:57/202 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARD 65
            |...::||:|.|:|.|:||:..|..|||::    ..|:...:...:.||.|.:..||::|:....
Human   112 NHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMG 176

  Fly    66 GYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRS-------QYR------- 116
            |....|.::|..:                         ..|.|||.:|       |.|       
Human   177 GQWLGGRQIRTNW-------------------------ATRKPPAPKSTQENNTKQLRFEDVVNQ 216

  Fly   117 ------VMVTGLPASGSWQDLKDHMREA----GDVCFADTYKD-GSGVVEFLRHEDMKYAIKKLD 170
                  .:..|..|||....|   ||:.    |.:.....:.: |...|.|..||...:||..::
Human   217 SSPKNCTVYCGGIASGLTDQL---MRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVN 278

  Fly   171 DSRFRSH 177
            .:....|
Human   279 GTTIEGH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 23/78 (29%)
RRM2_SRSF1_like 115..188 CDD:410013 17/81 (21%)
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 22/103 (21%)
RRM3_TIAR 222..294 CDD:241064 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.