DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Srsf6

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_080775.3 Gene:Srsf6 / 67996 MGIID:1915246 Length:339 Species:Mus musculus


Alignment Length:286 Identity:110/286 - (38%)
Similarity:144/286 - (50%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|..::|.||||..|..:|::..:||||..|    ||||||:|||||||...:..:..|.
Mouse     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYG----FVEFEDSRDADDAVYELNSKELCGE 63

  Fly    73 RLRVEFPRGGGPGSYRGGNRNDR------SRDGGG-----RMGGR---GPPAKRSQYRVMVTGLP 123
            |:.||..|         |.|.||      ||.|||     |..||   |||. |::||::|..|.
Mouse    64 RVIVEHAR---------G
PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPV-RTEYRLIVENLS 118

  Fly   124 ASGSWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRV 186
            :..|||||||.||:||:|.:||.:|:  ..||:||..:.|||.|:.|||.:......     ||:
Mouse   119 SRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRN-----IRL 178

  Fly   187 RED----------SGDNDRGGGGGGSGGGGGGSGGGGSRDY-RDRSRSRSFS---SRPRRRGTPT 237
            .||          ||...|......|......|....||.. :.||||||.|   ||.|.:|..:
Mouse   179 IEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKS 243

  Fly   238 YSPVRRQ--------SYSRSRSRSNY 255
            .|..:.:        |:|||||:..|
Mouse   244 RSKSKSKPKSDRGSHSHSRSRSKDKY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/71 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 32/74 (43%)
Srsf6NP_080775.3 RRM_SF 1..72 CDD:418427 34/81 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 10/27 (37%)
RRM2_SRSF6 110..182 CDD:410159 33/76 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.