DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and SNRNP70

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_003080.2 Gene:SNRNP70 / 6625 HGNCID:11150 Length:437 Species:Homo sapiens


Alignment Length:303 Identity:74/303 - (24%)
Similarity:97/303 - (32%) Gaps:92/303 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDL--KNRRGPP--FAFVEFEDARDADDAVKARDGYDY 69
            ::|..:..|.....::..|..:|.:..:.:  ..|.|.|  :||:|:|..||...|.|..||...
Human   105 LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKI 169

  Fly    70 DGYRLRVEFPR------------GGG-PGSYRGG---NRNDRSRDGGGRMGGRGPPAKRSQYRVM 118
            ||.|:.|:..|            ||| .|:.|||   |.....||...|...|..|:.       
Human   170 DGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSP------- 227

  Fly   119 VTGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAY 183
               ||.....:|.:...||      ....:|........|..|.:...:..|....|        
Human   228 ---LPHRDRDRDRERERRE------RSRERDKERERRRSRSRDRRRRSRSRDKEERR-------- 275

  Fly   184 IRVREDSGDND------------------------RGGGG--------------GGSGGGGGGSG 210
             |.||.|.|.|                        |||||              .|..|..|..|
Human   276 -RSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDG 339

  Fly   211 GGGSRDY-RDRSRSRSFSSRPRRRGTPTYSPVRRQSYSRSRSR 252
            ..|..:. |||.|.|..|.|..|.        ||:...|.|.|
Human   340 PDGPEEKGRDRDRERRRSHRSERE--------RRRDRDRDRDR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 21/74 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 11/72 (15%)
SNRNP70NP_003080.2 U1snRNP70_N 3..93 CDD:403437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..79
Required for interaction with U1 RNA. /evidence=ECO:0000269|PubMed:2467746 92..202 26/96 (27%)
RRM_snRNP70 102..187 CDD:409682 22/81 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..437 52/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.