DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and SC35

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:82/249 - (32%) Gaps:123/249 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VGNLPPDIRTKDIQDLFHKFGKVTFV----DLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG 71
            |.||......:|::.:|.:.|:|..:    |...|....||||.|.|.|||:||::|.||...||
  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91

  Fly    72 YRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKDHMR 136
            ..|||:..|.|.|.|        .:|...||.|                                
  Fly    92 RELRVQMAR
YGRPSS--------PTRSSSGRRG-------------------------------- 116

  Fly   137 EAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGGGGGG 201
                                                                             
  Fly   117 ----------------------------------------------------------------- 116

  Fly   202 SGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTYSPVRRQSYSRSRSRSNY 255
             |||||||||      |.||||||    |.||  .:.|| ||:|||||||..::
  Fly   117 -GGGGGGSGG------RRRSRSRS----PMRR--RSRSP-RRRSYSRSRSPGSH 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 28/72 (39%)
RRM2_SRSF1_like 115..188 CDD:410013 0/72 (0%)
SC35NP_001188794.1 RRM <24..>100 CDD:223796 28/72 (39%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.