DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf6b

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001008732.1 Gene:srsf6b / 494133 ZFINID:ZDB-GENE-041219-1 Length:355 Species:Danio rerio


Alignment Length:290 Identity:109/290 - (37%)
Similarity:139/290 - (47%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|...:|.||||..|..:||:...||||..|    ||||||.|||||||...:|.:..|.
Zfish     3 RVYIGKLSYHVREKDIQRFFGGYGKLMETDLKNGYG----FVEFEDTRDADDAVYELNGKELCGE 63

  Fly    73 RLRVEFPR---------GGGPGSYRGGNRN----DRSRDGGGRMGGRGPPAKRSQYRVMVTGLPA 124
            |:.||..|         |||.|.: ||..|    .|||.|..:.   |||. |::||::|..|.:
Zfish    64 RVIVEHARGPRRDRDGYGGGYGGF-GGRSNSGYSSRSRSGRDKY---GPPV-RTEYRLIVENLSS 123

  Fly   125 SGSWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLD----------------- 170
            ..|||||||.||:||:|.:||.:|:  ..||:||..|.||:.|:.|||                 
Zfish   124 RCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSHSDMRRALDKLDVTDINGRKIRLVEDKPR 188

  Fly   171 ------DSRFRSHEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSR------S 223
                  .||.||.....:..|.|..|....|......|......|..|  |.||.|||      |
Zfish   189 RRRSYSASRSRSRSRRRSRSRSRRSSRSQSRSRSRSRSRSKHSRSRSG--RKYRSRSRSSRKSHS 251

  Fly   224 RSFSSRPRRRGTPTYSPVRRQSYSRSRSRS 253
            :|.|.:.|.|........|.:|.|||:::|
Zfish   252 KSHSKKSRSRSRSRTEKSRSRSRSRSKAKS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 35/71 (49%)
RRM2_SRSF1_like 115..188 CDD:410013 35/97 (36%)
srsf6bNP_001008732.1 RRM1_SRSF6 3..72 CDD:241040 35/72 (49%)
RRM <3..>71 CDD:223796 35/71 (49%)
RRM <108..>187 CDD:223796 33/79 (42%)
RRM2_SRSF4_like 114..185 CDD:241044 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.