DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf5a

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_031746174.1 Gene:srsf5a / 448104 XenbaseID:XB-GENE-5954653 Length:297 Species:Xenopus tropicalis


Alignment Length:262 Identity:91/262 - (34%)
Similarity:129/262 - (49%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG 71
            ||:::|.|.|..|.:|::..|..:|::..::|||    .|.||||:|.|||||||...:|.....
 Frog    39 CRVFIGRLSPHARERDVEKFFKGYGRIREINLKN----GFGFVEFDDHRDADDAVYELNGKVLCN 99

  Fly    72 YRLRVEFPR----------GGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASG 126
            .|:.:|..|          |||.|..|..||....:...|.....|||. |:::|::|..|.:..
 Frog   100 ERVTIEHARNRRGRGGMMGGGGGGGGRYPNRFAYRQSNSGGPSRYGPPV-RTEHRIIVENLSSRV 163

  Fly   127 SWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVRED 189
            |||||||.||:||:|.:.|.::.  ..|||||..:.|||.|:.|||.......:     |::.||
 Frog   164 SWQDLKDFMRKAGEVTYVDAHRSNRNEGVVEFASYTDMKNALDKLDGVELSGRK-----IKLTED 223

  Fly   190 SGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFS---SRPRRRGTPTYSPVRRQSYSRSRS 251
                                    |:..|.||||||.|   |:.:.||:       .:|.|||||
 Frog   224 ------------------------SKKRRSRSRSRSHSRSRSKSKSRGS-------SKSASRSRS 257

  Fly   252 RS 253
            :|
 Frog   258 KS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 28/72 (39%)
RRM2_SRSF1_like 115..188 CDD:410013 29/74 (39%)
srsf5aXP_031746174.1 RRM1_SRSF4_like 40..108 CDD:409774 27/71 (38%)
RRM2_SRSF4_like 152..223 CDD:410012 29/75 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.