DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf9

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001004795.1 Gene:srsf9 / 448015 XenbaseID:XB-GENE-491310 Length:225 Species:Xenopus tropicalis


Alignment Length:243 Identity:127/243 - (52%)
Similarity:162/243 - (66%) Gaps:44/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRG---PPFAFVEFEDARDADDAVKARDGYDY 69
            ||||||||.|||.|:::|||.::|::..::||||.|   .||||:.|:|.|||:|||.||:||::
 Frog    17 RIYVGNLPADIREKELEDLFDRYGRIRTIELKNRGGSSAAPFAFISFQDPRDAEDAVFARNGYEF 81

  Fly    70 DGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGR---GPPAKRSQYRVMVTGLPASGSWQDL 131
            ...||||||||     |:||        .|||..|.|   |||::||:|||:|:|||.|||||||
 Frog    82 GSCRLRVEFPR-----SFRG--------SGGGYGGSRGRNGPPSRRSEYRVIVSGLPPSGSWQDL 133

  Fly   132 KDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRG 196
            |||||||||||:||.:|||.|:|||:|.|||:||::||||::|||||||.:||||..:.      
 Frog   134 KDHMREAGDVCYADVHKDGMGIVEFIRKEDMEYALRKLDDTKFRSHEGETSYIRVCPER------ 192

  Fly   197 GGGGGSGGGGGGSGGGGSRDY-RDRSRSRSFSSRPRRRGTPTY-SPVR 242
                             :..| |.|||||...|..:.|.:|.| ||.|
 Frog   193 -----------------NTSYSRSRSRSRGRDSPYQSRRSPRYASPFR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 43/74 (58%)
RRM2_SRSF1_like 115..188 CDD:410013 55/72 (76%)
srsf9NP_001004795.1 RRM_SF 17..90 CDD:388407 41/72 (57%)
RRM2_SRSF9 117..191 CDD:241212 55/73 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6226
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D523875at33208
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.