DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf5

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001004783.1 Gene:srsf5 / 448003 XenbaseID:XB-GENE-487049 Length:272 Species:Xenopus tropicalis


Alignment Length:255 Identity:101/255 - (39%)
Similarity:129/255 - (50%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG 71
            ||:::|.|.|..|.||::..|..:|::..:|||  ||  |.||||:|.|||||||...||.:...
 Frog     4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLK--RG--FGFVEFDDPRDADDAVYELDGKELCN 64

  Fly    72 YRLRVEFPR---GGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKD 133
            .|:.:|..|   .|||.....|..|||......| |.|..|..|::.|::|..|.:..|||||||
 Frog    65 ERVTIEHARLRSRGGPRGLGRGRYNDRFSSRRPR-GDRSAPPIRTENRLIVENLSSRVSWQDLKD 128

  Fly   134 HMREAGDVCFADTY--KDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRG 196
            .||:||:|.|||.:  |...|||||..:.|:|.||:||........:     |::.|        
 Frog   129 FMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNAIEKLSGKEINGRK-----IKLIE-------- 180

  Fly   197 GGGGGSGGGGGGSGGGGSRDYRDRSRSRS---FSSRPRRRGTPTYSPVRRQSYSRSRSRS 253
                           |..|..|.||||||   .|||.|.|....    .|:|||||||||
 Frog   181 ---------------GNKRHSRSRSRSRSRSRSSSRSRSRSRSR----SRKSYSRSRSRS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 32/72 (44%)
RRM2_SRSF1_like 115..188 CDD:410013 31/74 (42%)
srsf5NP_001004783.1 RRM1_SRSF4_like 5..73 CDD:240783 31/71 (44%)
RRM2_SRSF4_like 110..180 CDD:241044 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.