DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SF2 and mod

DIOPT Version :9

Sequence 1:	NP_001247139.1	Gene:	SF2 / 53443	FlyBaseID:	FBgn0283477	Length:	255	Species:	Drosophila melanogaster
Sequence 2:	NP_001247401.1	Gene:	mod / 43764	FlyBaseID:	FBgn0002780	Length:	542	Species:	Drosophila melanogaster

Alignment Length:	58	Identity:	19/58 - (32%)
Similarity:	27/58 - (46%)	Gaps:	0/58 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVK 62
            ||..:.||.:.|:|...|::..|.|...|..|.:.:.|..|.|||......|...|:|
  Fly   256 NERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPRAFVRLASVDDIPKALK 313

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SF2	NP_001247139.1	RRM_SF	3..80	CDD:418427	19/58 (33%)
SF2	NP_001247139.1	RRM2_SRSF1_like	115..188	CDD:410013
mod	NP_001247401.1	RRM_SF	177..244	CDD:302621
		RRM_SF	260..327	CDD:240668	17/54 (31%)
		RRM_SF	342..411	CDD:240668
		RRM_SF	422..>465	CDD:302621
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR23147
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100