DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf5b

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001002610.1 Gene:srsf5b / 436883 ZFINID:ZDB-GENE-040718-354 Length:285 Species:Danio rerio


Alignment Length:283 Identity:108/283 - (38%)
Similarity:139/283 - (49%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG 71
            |||::|.|.|..|.||::..|..:|::..:|||  ||  |.||||:|.|||:|||...||.:...
Zfish     4 CRIFIGRLNPSAREKDVERFFKGYGRIRDIDLK--RG--FGFVEFDDPRDAEDAVYELDGKELCN 64

  Fly    72 YRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMG---GRG-------PPAKRSQYRVMVTGLPASG 126
            .|:.:|..|    ...|||    |.|.||||..   |||       ||..|::.|::|..|.:..
Zfish    65 ERVTIEHAR----VRLRGG----RGRGGGGRFPARYGRGSQDSRRNPPPMRTENRLIVENLSSRV 121

  Fly   127 SWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKL-------------DDSRFRS 176
            |||||||.||:||:|.|||.::.  ..|||||..|.|:|.|::||             :.||.:|
Zfish   122 SWQDLKDFMRQAGEVTFADAHRPNLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLVEASRKKS 186

  Fly   177 HEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRR--------R 233
            ..      |.|.:|....|..|...|...............|.||||||.|:.|.|        .
Zfish   187 RS------RSRSNSSSRSRSRGRSASRSRSRSRSHSPKSHNRSRSRSRSASASPVRPKEAPRPES 245

  Fly   234 GTPTYS---PVRRQSYSRSRSRS 253
            .:|..|   |.|.:|.|||||||
Zfish   246 ASPPASAQHPPRSRSRSRSRSRS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 32/72 (44%)
RRM2_SRSF1_like 115..188 CDD:410013 33/87 (38%)
srsf5bNP_001002610.1 RRM1_SRSF4_like 5..73 CDD:240783 31/71 (44%)
RRM2_SRSF4_like 110..180 CDD:241044 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.