DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Rox8

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:213 Identity:54/213 - (25%)
Similarity:87/213 - (40%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDY 69
            |:||:|.|:|.|:.:::.|..||:::    ..|....:...:|||.|....:|::|::|.:|...
  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161

  Fly    70 DGYRLRVEF-------PRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYR----------- 116
            ....:|..:       ||....|..:||..      |||  .|.|...|.||..           
  Fly   162 GSRSIRTNWSTRKLPPPREPSKGGGQGGGM------GGG--PGNGSGVKGSQRHTFEEVYNQSSP 218

  Fly   117 ----VMVTGLPASGSWQDL-KDHMREAGDVCFADTYKD-GSGVVEFLRHEDMKYAIKKLDDSRFR 175
                |...|.|.:....|| ..|..:.|.:.....:|| |...::|:..|...:||:...:|.. 
  Fly   219 TNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEV- 282

  Fly   176 SHEGEVAYIRVREDSGDN 193
             |...|.....:|:.|||
  Fly   283 -HGNLVKCFWGKENGGDN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 20/81 (25%)
RRM2_SRSF1_like 115..188 CDD:410013 17/89 (19%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 45/184 (24%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 20/72 (28%)
RRM3_TIA1_like 221..294 CDD:240800 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.